PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002384
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 416aa    MW: 47508.1 Da    PI: 6.6157
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002384genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.4e-17134180148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed llv+ v q+G++ W+ Ia++++ gR +kqc++rw+++l
      Lus10002384 134 KGQWTIDEDRLLVQFVGQYGTKKWSYIAQMLP-GRIGKQCRERWHNHL 180
                      799*****************************.*************97 PP

2Myb_DNA-binding48.32.3e-15186228145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT++Ed+ l++ + + G++ W+ Ia++++ gRt++++k++w+
      Lus10002384 186 KDTWTEDEDKVLIHSHIEIGNK-WAEIAKRLP-GRTENSIKNHWN 228
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.046129184IPR017930Myb domain
SuperFamilySSF466893.01E-30131227IPR009057Homeodomain-like
SMARTSM007171.8E-13133182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-26135188IPR009057Homeodomain-like
PfamPF139214.9E-16137195No hitNo description
CDDcd001671.51E-12137180No hitNo description
SMARTSM007171.6E-14185233IPR001005SANT/Myb domain
PROSITE profilePS5129419.028185235IPR017930Myb domain
CDDcd001678.73E-11188231No hitNo description
Gene3DG3DSA:1.10.10.603.2E-20189233IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MEHETDTFVS SQALFMPQNN YNMTTLSHHH HRHPPPNFQE PPSQLQSTVF PQEEDHLFGQ  60
NIGSSSNQVF GVNTWSNLDS YDVYSYGSSS SNNYESECKP FANINGEKFN NQMVNMVAAP  120
VDKKTWKGKK NVVKGQWTID EDRLLVQFVG QYGTKKWSYI AQMLPGRIGK QCRERWHNHL  180
KPDIKKDTWT EDEDKVLIHS HIEIGNKWAE IAKRLPGRTE NSIKNHWNAT KRKQYSKRKC  240
RSTKYPRTSI LQDYIKSLNL VNSTSNKRSS SSKNNTTNAA TATSSAIIPA APLPLARRPE  300
HNNSESLLHP QLSMDHLYEE NDRLVPDFDF MSNEEVPDFG VDDEMFQDGC SIESLLDGLS  360
SCEPLVDEKS FNKSVEDAML SMPFEVKKEM DLVEIDEFTG KGPLNHSPNI YMLKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-421322342104C-Myb DNA-Binding Domain
1msf_C2e-421322342104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511387.21e-103PREDICTED: transcription factor MYB98
SwissprotQ9S7L27e-79MYB98_ARATH; Transcription factor MYB98
TrEMBLB9RB121e-104B9RB12_RICCO; Myb119, putative
STRINGVIT_17s0000g08550.t012e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-74myb domain protein 98